HLA-Inception Web Interface

Predict MHC-I peptides using HLA-Inception

Note: This interface connects to the HLA-Inception prediction service. Upload your FASTA file or enter peptide sequences to get MHC-I binding predictions.

Run a Prediction

Upload a FASTA file containing protein sequences. One per line. Peptides must be 8-15 amino acids in length.

Enter target MHC-I allele(s) for prediction. Multiple alleles should be separated by commas without spaces. Alleles must be formatted to 4-digit resolution without asterisks (e.g., A_02:01).

Enter peptide lengths for predictions. Multiple lengths should be separated by commas. Peptides must be 8-15 amino acids in length.

Enter the threshold for binding predictions when doing FASTA predictions. Higher values are more stringent.

About HLA-Inception

HLA-Inception is a tool for predicting MHC-I peptides. It uses a combination of physical modeling and machine learning to predict peptide binding to MHC-I molecules.

Examples

FASTA file predictions

Predict A_02:01 9mer peptides with a binding percentile of 99.5 or higher:

./hla-inception -i test.fasta -l 9 -a A_02:01 -threshold 99.5

Peptide predictions

Predict binding affinity of peptides to A_02:01:

./hla-inception -i peptides.txt -P 1 -a A_02:01

Sample FASTA Data

You can copy and paste this sample FASTA data into a text file with a .fasta extension to test file upload:

>sp|P0DTC1|R1A_SARS2 Replicase polyprotein 1a OS=Severe acute respiratory syndrome coronavirus 2
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVL
PQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVL
LRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAY
TRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYY
TERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIR
SVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLP
QNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCV

Or, you can enter these sample peptides in the Peptide List input:

YLQPRTFLL
QLFRVYAAY
KLNDLCFSL
LLMKCDHCL
HLATVKVCL

Using this interface

This web interface connects to the HLA-Inception prediction service. Upload your FASTA file or enter peptide sequences, configure your parameters, and click Run Prediction to get MHC-I binding predictions for your data.